Home > Products > MS Protein Standards > MS Grade Myoglobin

MS Grade Myoglobin

INQUIRY>

Product Description


NameMS Grade Myoglobin
Cat#CPAS100046
AccessionP68082
Molecular Weight16951
Protein Sequence>CPAS100046
GLSDGEWQQVLNVWGKVEADI
AGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASE
DLKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKH
KIPIKYLEFISDAIIHVLHSKHPGDFGADAQGAMTKAL
ELFRNDIAAKYKELGFQG
SourceEquine Heart

Online Inquiry


Please input "proteomics" as verification code.