Home > Products > MS Protein Standards > MS Grade Carbonic Anhydrase

MS Grade Carbonic Anhydrase

INQUIRY>

Product Description


NameMS Grade Carbonic Anhydrase
Cat#CPAS100043
AccessionP00921
Molecular Weight29024
Protein Sequence>CPAS100043

SHHWGYGKHNGPEHWHKDFPIANGERQSPVDIDTKAVV
QDPALKPLALVYGEATSRRMVNNGHSFNVEYDDSQDKA
VLKDGPLTGTYRLVQFHFHWGSSDDQGSEHTVDRKKYA
AELHLVHWNTKYGDFGTAAQQPDGLAVVGVFLKVGDAN
PALQKVLDALDSIKTKGKSTDFPNFDPGSLLPNVLDYW
TYPGSLTTPPLLESVTWIVLKEPISVSSQQMLKFRTLN
FNAEGEPELLMLANWRPAQPLKNRQVRGFPK
Sourcebovine erythrocytes

Online Inquiry


Please input "proteomics" as verification code.