NT5C Full-Length MS Protein Standard

5, 3-nucleotidase, cytosolic

NT5C Full-Length MS Protein Standard (NP_055410), Labeled with [U- ¹³C₆, ¹⁵N₄]-L-Arginine and [U- ¹³C₆, ¹⁵N₂]-L-Lysine, was produced in human 293 cells (HEK293) with fully chemically defined cell culture medium to obtain incorporation efficiency at Creative-Proteomics. This gene encodes a nucleotidase that catalyzes the dephosphorylation of the 5 deoxyribonucleotides (dNTP) and 2(3)-dNTP and ribonucleotides, but not 5 ribonucleotides. Of the different forms of nucleotidases characterized, this enzyme is unique in its preference for 5-dNTP. It may be one of the enzymes involved in regulating the size of dNTP pools in cells. Alternatively spliced transcript variants have been found for this gene.

NT5C

cdN; DNT; dNT-1; DNT1; HEL74; P5N2; PN-I; PN-II; UMPH2

NM_014595

17q25.1

[U- ¹³C₆, ¹⁵N₄]-L-Arg and [U- ¹³C₆, ¹⁵N₂]-L-Lys

> 80% as determined by SDS-PAGE and Coomassie blue staining

Human HEK293 cells

23.2 kDa

RC204265

>RC204265 representing NM_014595
MARSVRVLVDMDGVLADFEAGLLRGFRRRFPEEPHVPLEQRRGFLAREQYRALRPDLADKVASVYEAPGF
FLDLEPIPGALDAVREMNDLPDTQVFICTSPLLKYHHCVGEKYRWVEQHLGPQFVERIILTRDKTVVLGD
LLIDDKDTVRGQEETPSWEHILFTCCHNRHLVLPPTRRRLLSWSDNWREILDSKRGAAQRE