CHSY3 Fragment MS Protein Standard

Chondroitin sulfate synthase 3

CHSY3 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human CHSY3 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

CHSY3

Carbohydrate synthase 2, Chondroitin glucuronyltransferase 3, Chondroitin synthase 2, Glucuronosyl-N-acetylgalactosaminyl-proteoglycan 4-beta-N-acetylgalactosaminyltransferase II, N-acetylgalactosaminyl-proteoglycan 3-beta-glucuronosyltransferase 3, N-ace

Q70JA7

LVIILFSRDSGQDSSKHIELIKGYQNKYPKAEMTLIPMKGEFSRGLGLEMASAQFDNDTLLLFCDVDLIFR