HLA-DQB2 Fragment MS Protein Standard

HLA class II histocompatibility antigen, DQ beta 2 chain

HLA-DQB2 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human HLA-DQB2 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

HLA-DQB2

HLA class II histocompatibility antigen, DX beta chain, MHC class II antigen DQB2

P05538

GRSIEDWNNYKDFLEQERAAVDKVCRHNYEAELRTTLQRQVEPTVTIS