NCOA3 Fragment MS Protein Standard

Nuclear receptor coactivator 3

NCOA3 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human NCOA3 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

NCOA3

ACTR, Amplified in breast cancer 1 protein, CBP-interacting protein, Class E basic helix-loop-helix protein 42, Receptor-associated coactivator 3, Steroid receptor coactivator protein 3, Thyroid hormone receptor activator molecule 1

Q9Y6Q9

PSKVSNQDSKSPLGFYCDQNPVESSMCQSNSRDHLSDKESKESSVEGAENQRGPLESKGHKKLLQLLTCSSDDRGHSSLTNSPLDSSCK