PRSS21 Fragment MS Protein Standard

Testisin

PRSS21 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human PRSS21 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

PRSS21

Eosinophil serine protease 1, Serine protease 21

Q9Y6M0

CFETYSDLSDPSGWMVQFGQLTSMPSFWSLQAYYTRYFVSNIYLSPRYLGNSPYDIALVKLSAPVTYTKHIQPICLQASTFEFENRTDCWVTGWGYIKEDEALPSPHTL