KCNE2 Fragment MS Protein Standard

Potassium voltage-gated channel subfamily E member 2

KCNE2 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human KCNE2 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

KCNE2

MinK-related peptide 1, Minimum potassium ion channel-related peptide 1, Potassium channel subunit beta MiRP1

Q9Y6J6

STVKSKRREHSNDPYHQYIVEDWQEKYKSQILNLEESKATIHENIGAAGFKMS