ARFGEF1 Fragment MS Protein Standard

Brefeldin A-inhibited guanine nucleotide-exchange protein 1

ARFGEF1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human ARFGEF1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

ARFGEF1

ADP-ribosylation factor guanine nucleotide-exchange factor 1, p200 ARF guanine nucleotide exchange factor, p200 ARF-GEP1

Q9Y6D6

QALQEAKQMEKERHRQHHHLLQSPVSHHEPESPQLRYLPPQTVDHISQEHEGDLDLHTNDVDKSLQDDTEPENGSDISSAENEQTEA