NR2E3 Fragment MS Protein Standard

Photoreceptor-specific nuclear receptor

NR2E3 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human NR2E3 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

NR2E3

Nuclear receptor subfamily 2 group E member 3, Retina-specific nuclear receptor

Q9Y5X4

AETCAKLEPEDADENIDVTSNDPEFPSSPYSSSSPCGLDSIHETSARLLFMAVKWAKNLPVFSSLPFRDQVILLEEAWSELFLLGAIQWSLPLDSCPLLAPPEASAAGGAQGRLTLASMETRVLQETISRF