GTF3C5 Fragment MS Protein Standard

General transcription factor 3C polypeptide 5

GTF3C5 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human GTF3C5 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

GTF3C5

TF3C-epsilon, Transcription factor IIIC 63 kDa subunit, Transcription factor IIIC subunit epsilon

Q9Y5Q8

RLELYFRPKDPYCHPVCANRFSTSSLLLRIRKRTRRQKGVLGTEAHSEVTFDMEILGIISTIYKFQGMSDFQYLAVHTEAGGKHTSMYDKVLMLRPEK

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!