RIPK3 Fragment MS Protein Standard

Receptor-interacting serine/threonine-protein kinase 3

RIPK3 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human RIPK3 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

RIPK3

RIP-like protein kinase 3, Receptor-interacting protein 3

Q9Y572

EMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPG