MFHAS1 Fragment MS Protein Standard

Malignant fibrous histiocytoma-amplified sequence 1

MFHAS1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human MFHAS1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

MFHAS1

Malignant fibrous histiocytoma-amplified sequence with leucine-rich tandem repeats 1

Q9Y4C4

AYYGVSDKNLRRRKAHFQYLLNHRLQILSPVLPVSCRDPRHLRRLRDKLLSVAEHREIFPNLHRVLPRSWQVLEELHFQPPQAQRLWL