MTCL1 Fragment MS Protein Standard

Microtubule cross-linking factor 1

MTCL1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human MTCL1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

MTCL1

Coiled-coil domain-containing protein 165, PAR-1-interacting protein, SOGA family member 2

Q9Y4B5

DRGCGFPVGEHSPHSRVQIGDHSLRLQTADRGQPHKQVVENQQLFSAFKALLEDFRAELREDERARLRLQQQYASDKAAWDVEWAVLK