PAM16 Fragment MS Protein Standard

Mitochondrial import inner membrane translocase subunit TIM16

PAM16 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human PAM16 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

PAM16

Mitochondria-associated granulocyte macrophage CSF-signaling molecule, Presequence translocated-associated motor subunit PAM16

Q9Y3D7

VQKNYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELKIQAQEDREKGQMPHT