COA3 Fragment MS Protein Standard

Cytochrome c oxidase assembly factor 3 homolog, mitochondrial

COA3 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human COA3 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

COA3

Coiled-coil domain-containing protein 56, Mitochondrial translation regulation assembly intermediate of cytochrome c oxidase protein of 12 kDa

Q9Y2R0

PTREKLTPEQLHSMRQAELAQWQKVLPRRRTRNI