POMP Fragment MS Protein Standard

Product Information
Protein Name
Proteasome maturation protein
Description
POMP Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human POMP protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.
Symbol
POMP
Synonyms
Proteassemblin, Protein UMP1 homolog, Voltage-gated K channel beta subunit 4.1
Uniprot ID
Q9Y244
Product Sequence
SELKDSIPVTELSASGPFESHDLLRKGFSCVKNELLPSHPLELSEKNFQLNQDKMNFSTLRNIQGLFAPLKLQMEFKAVQQVQR

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!

* This product is For Research Use Only. Do Not use in diagnostic or therapeutic procedures.
Related Products
2
Inquiry Basket