MAPK8IP1 Fragment MS Protein Standard

C-Jun-amino-terminal kinase-interacting protein 1

MAPK8IP1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human MAPK8IP1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

MAPK8IP1

Islet-brain 1, JNK MAP kinase scaffold protein 1, Mitogen-activated protein kinase 8-interacting protein 1

Q9UQF2

GVFPAYYAIEVTKEPEHMAALAKNSDWVDQFRVKFLGSVQVPYHKGNDVLC