COG5 Fragment MS Protein Standard

Conserved oligomeric Golgi complex subunit 5

COG5 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human COG5 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

COG5

13S Golgi transport complex 90 kDa subunit, Component of oligomeric Golgi complex 5, Golgi transport complex 1

Q9UP83

SFWTNMEKLMDHIYAVCGQVQHLQKVLAKKRDPVSHICFIEEIVKDGQPEIFYTFWNSVTQALSSQFHMATNSSMFLKQAFEGEYPKLLRLYNDLWKRLQQYSQHIQGNFN