MGAT4A Fragment MS Protein Standard

Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A

MGAT4A Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human MGAT4A protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

MGAT4A

N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase IVa, UDP-N-acetylglucosamine: alpha-1,3-D-mannoside beta-1,4-N-acetylglucosaminyltransferase IVa

Q9UM21

LLKIHVNPPAEVSTSLKVYQGHTLEKTYMGEDFFWAITPIAGDYILFKFDKPVNVESYLFHSGNQEHPGDILLNTTVEVLPFKSEGLEISKETKDKRLEDGYFRIGK