MED23 Fragment MS Protein Standard

Mediator of RNA polymerase II transcription subunit 23

MED23 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human MED23 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

MED23

Activator-recruited cofactor 130 kDa component, Cofactor required for Sp1 transcriptional activation subunit 3, Mediator complex subunit 23, Protein sur-2 homolog, Transcriptional coactivator CRSP130, Vitamin D3 receptor-interacting protein complex 130 kD

Q9ULK4

WIHLNRKAQNDNSKLQIPIPHSLRLHHEFLQQSLRNKSLQMNDYKIALLCNAYSTNSECFTLPMGALVETIYGNGIMRIPLPGTNCMA