TMPRSS11E Fragment MS Protein Standard

Transmembrane protease serine 11E

TMPRSS11E Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human TMPRSS11E protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

TMPRSS11E

Serine protease DESC1, Transmembrane protease serine 11E2

Q9UL52

VLAHMLLICRFHSTEDPETVDKIVQLVLHEKLQDAVGPPKVDPHSVKIKKINKTETDSYLNHCCGTRRSKTLGQSLRIVGG