SLC25A13 Fragment MS Protein Standard

Calcium-binding mitochondrial carrier protein Aralar2

SLC25A13 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human SLC25A13 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

SLC25A13

Citrin, Mitochondrial aspartate glutamate carrier 2, Solute carrier family 25 member 13

Q9UJS0

KVALTKRADPAELRTIFLKYASIEKNGEFFMSPNDFVTRYLNIFGESQPNPKTVELLSGVVDQTKDGLIS