PRSS50 Fragment MS Protein Standard

Probable threonine protease PRSS50

PRSS50 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human PRSS50 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

PRSS50

Cancer/testis antigen 20, Serine protease 50, Testis-specific protease-like protein 50

Q9UI38

GLSKADGMWPQFRTIQEKEVIILNNKECDNFYHNFTKIPTLVQIIKSQMMCAEDTHREKFCYELTGEPLVCSMEGTWYL