CLEC2D Fragment MS Protein Standard

C-type lectin domain family 2 member D

CLEC2D Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human CLEC2D protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

CLEC2D

Lectin-like NK cell receptor, Lectin-like transcript 1, Osteoclast inhibitory lectin

Q9UHP7

RANCHQEPSVCLQAACPESWIGFQRKCFYFSDDTKNWTSSQRFCDSQDADLAQVESFQELNFLLRYKGPSDHWIGLSREQGQPWK