VTI1B Fragment MS Protein Standard

Vesicle transport through interaction with t-SNAREs homolog 1B

VTI1B Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human VTI1B protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

VTI1B

Vesicle transport v-SNARE protein Vti1-like 1, Vti1-rp1

Q9UEU0

ASSEHFEKLHEIFRGLHEDLQGVPERLLGTAGTEEKKKLIRDFDEKQQEANETLAEMEEELRYAPLSFRNPMMSKLRNYRKDLAKLHREVRSTPLTATPGGR