COPS7A Fragment MS Protein Standard

COP9 signalosome complex subunit 7a

COPS7A Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human COPS7A protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

COPS7A

Dermal papilla-derived protein 10, JAB1-containing signalosome subunit 7a

Q9UBW8

KVTGQNQEQFLLLAKSAKGAALATLIHQVLEAPGVYVFGELLDMPNVRELAESDFASTFRLLTVFAYGTYADYLAEARNLPPLTEAQKNKLR

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!