MGAT4C Fragment MS Protein Standard

Product Information
Protein Name
Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase C
Description
MGAT4C Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human MGAT4C protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.
Symbol
MGAT4C
Synonyms
N-acetylglucosaminyltransferase IV homolog, N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase IVc, UDP-N-acetylglucosamine: alpha-1,3-D-mannoside beta-1,4-N-acetylglucosaminyltransferase IVc
Uniprot ID
Q9UBM8
Product Sequence
YKGTENKLKDDDFEEESFDIPDNPPASLYTNMNVFENYEASKAYSSVDEYFWGKPPSTGDVFVIVFENPIIIKKIKVNTGTEDRQNDILHHGALDVGENVMPSKQRRQCSTYLRLGEFK

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!

* This product is For Research Use Only. Do Not use in diagnostic or therapeutic procedures.
Related Products
2
Inquiry Basket