HECW2 Fragment MS Protein Standard

E3 ubiquitin-protein ligase HECW2

HECW2 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human HECW2 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

HECW2

HECT, C2 and WW domain-containing protein 2, NEDD4-like E3 ubiquitin-protein ligase 2

Q9P2P5

TATCSERSMGASPKLRSSFPTDTRLNAMLHIDSDEEDHEFQQDLGYPSSLEEEGGLIMFSRASRADDGSLTSQTKLEDNPVENEEASTHEAASFEDKPENLP