KANSL3 Fragment MS Protein Standard

KAT8 regulatory NSL complex subunit 3

KANSL3 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human KANSL3 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

KANSL3

NSL complex protein NSL3, Non-specific lethal 3 homolog, Serum inhibited-related protein, Testis development protein PRTD

Q9P2N6

PVLFVIGQNSLQCHPEAMEDFREKIRAENSLVVVGGADDNLRISKAKKKSEGLTQSMVDRCIQDEIVDFLTGVLTRAEGHMGSEPRDQDAEKKKKPR