PLCE1 Fragment MS Protein Standard

1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1

PLCE1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human PLCE1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

PLCE1

Pancreas-enriched phospholipase C, Phosphoinositide phospholipase C-epsilon-1, Phospholipase C-epsilon-1

Q9P212

MGISPLGNQSVIIETGRAHPDSRRAVFHFHYEVDRRMSDTFCTLSENLILDDCGNCVPLPGGEEKQKKNYVAYTCKLMELAKNCDNKNEQLQCDHCDTLNDKYFCFEGSCEK