NDUFA13 Fragment MS Protein Standard

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13

NDUFA13 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human NDUFA13 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

NDUFA13

Cell death regulatory protein GRIM-19, Complex I-B16.6, Gene associated with retinoic and interferon-induced mortality 19 protein, NADH-ubiquinone oxidoreductase B16.6 subunit

Q9P0J0

IMKWNRERRRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPLIGELYGLRTTEEALHASHGFMWYT