GPR83 Fragment MS Protein Standard

Probable G-protein coupled receptor 83

GPR83 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human GPR83 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

GPR83

G-protein coupled receptor 72

Q9NYM4

RADEQSAEAALAVPNASHFFSWNNYTFSDWQNFVGRRRYGAESQNPTVKALL