ZAK Fragment MS Protein Standard

Mitogen-activated protein kinase kinase kinase MLT

ZAK Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human ZAK protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

ZAK

Human cervical cancer suppressor gene 4 protein, Leucine zipper- and sterile alpha motif-containing kinase, MLK-like mitogen-activated protein triple kinase, Mixed lineage kinase-related kinase, Sterile alpha motif- and leucine zipper-containing kinase AZ

Q9NYL2

FHNHTTHMSLVGTFPWMAPEVIQSLPVSETCDTYSYGVVLWEMLTREVPFKGLEGLQVAWLVVEKNERLTIPSSCPRSFAELLHQCWEADAKKRPSFKQIISILESMSNDTSLPDKCN