GAR1 Fragment MS Protein Standard

H/ACA ribonucleoprotein complex subunit 1

GAR1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human GAR1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

GAR1

Nucleolar protein family A member 1, snoRNP protein GAR1

Q9NY12

GRGGFNKGQDQGPPERVVLLGEFLHPCEDDIVCKCTT