NMRK1 Fragment MS Protein Standard

Nicotinamide riboside kinase 1

NMRK1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human NMRK1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

NMRK1

Nicotinic acid riboside kinase 1, Ribosylnicotinamide kinase 1, Ribosylnicotinic acid kinase 1

Q9NWW6

DDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVVSTDQESAEEIPILIIEGFLLFNYKPLDTIWNRS