HIF1AN Fragment MS Protein Standard

Hypoxia-inducible factor 1-alpha inhibitor

HIF1AN Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human HIF1AN protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

HIF1AN

Factor inhibiting HIF-1, Hypoxia-inducible factor asparagine hydroxylase

Q9NWT6

KGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQE