PDS5B Fragment MS Protein Standard

Sister chromatid cohesion protein PDS5 homolog B

PDS5B Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human PDS5B protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

PDS5B

Androgen-induced proliferation inhibitor, Androgen-induced prostate proliferative shutoff-associated protein AS3

Q9NTI5

GSQRSRKRGHTASESDEQQWPEEKRLKEDILENEDEQNSPPKKGKRGRPPKPLGGGTPKEEPTMKTSKKGSKKKSGPPAPEEEE