IL17RB Fragment MS Protein Standard

Interleukin-17 receptor B

IL17RB Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human IL17RB protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

IL17RB

Cytokine receptor-like 4, IL-17 receptor homolog 1, Interleukin-17B receptor

Q9NRM6

EFLQNHCRSEVILEKWQKKKIAEMGPVQWLATQKKAADKVVFLLSNDVNSVCDGTCGKSEGSPSENSQDLFPLAFNLFCSDLRSQIHLHK

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!