KCNQ5 Fragment MS Protein Standard

Potassium voltage-gated channel subfamily KQT member 5

KCNQ5 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human KCNQ5 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

KCNQ5

KQT-like 5, Potassium channel subunit alpha KvLQT5, Voltage-gated potassium channel subunit Kv7.5

Q9NR82

LALASFQIPPFECEQTSDYQSPVDSKDLSGSAQNSGCLSRSTSANISRGLQFILTPNEFSAQTFYALSPTMHSQATQVPISQSDGSAVAATNTIANQINTAPKPAAPTTLQIPPPL