POLE4 Fragment MS Protein Standard

DNA polymerase epsilon subunit 4

POLE4 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human POLE4 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

POLE4

DNA polymerase II subunit 4, DNA polymerase epsilon subunit p12

Q9NR33

VPGARLSRLPLARVKALVKADPDVTLAGQEAIFILARAAELFVETIAKDAYCCAQQGKRKTLQRRDLDNAIEAVDEFAFLEGTL