NOX4 Fragment MS Protein Standard

NADPH oxidase 4

NOX4 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human NOX4 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

NOX4

Kidney oxidase-1, Kidney superoxide-producing NADPH oxidase, Renal NAD(P)H-oxidase

Q9NPH5

LDDWKPYKLRRLYFIWVCRDIQSFRWFADLLCMLHNKFWQENRPDYVNIQLYLSQTDGIQKIIGEKYHALNSRLFIGRPRWKLLFDEIAKYNRGKTVGVFCCGPNSLSKTL