IL1RAPL2 Fragment MS Protein Standard

X-linked interleukin-1 receptor accessory protein-like 2

IL1RAPL2 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human IL1RAPL2 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

IL1RAPL2

IL1RAPL-2-related protein, Interleukin-1 receptor 9, Three immunoglobulin domain-containing IL-1 receptor-related 1

Q9NP60

SKSSKLNSKFWKHLVYEMPIKKKEMLPRCHVLDSAEQGLFGELQPIPSIAMTSTSATLVSSQADLPEFHPSDSMQIRHCCRGYKHEIPATTLPVPSLGNHHTYCNLPLTLLNGQLPLNNTLKDTQEFHRNSSLLP