ERVK-5 Fragment MS Protein Standard

Endogenous retrovirus group K member 5 Gag polyprotein

ERVK-5 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human ERVK-5 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

ERVK-5

HERV-K(II) Gag protein, HERV-K_3q12.3 provirus ancestral Gag polyprotein

Q9HDB9

ELQYLPPPESQYGYPGMPPALQGRAPYPQPPTVRLNPTASRSGQGGTLHAVIDEARKQGDLEAWRFLVILQLVQAGEETQVGAPARAETR

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!