CELSR2 Fragment MS Protein Standard

Cadherin EGF LAG seven-pass G-type receptor 2

CELSR2 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human CELSR2 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

CELSR2

Cadherin family member 10, Epidermal growth factor-like protein 2, Flamingo homolog 3, Multiple epidermal growth factor-like domains protein 3

Q9HCU4

SATQDVHFTENLLRVGSALLDTANKRHWELIQQTEGGTAWLLQHYEAYASALAQNMRHTYLSPFTIVTPNIVISVVRLDKGNFAGAKLPRYEALRGEQPPDLETTVILPESVFR