TMEM8A Fragment MS Protein Standard

Transmembrane protein 8A

TMEM8A Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human TMEM8A protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

TMEM8A

Protein M83, Transmembrane protein 6, Transmembrane protein 8

Q9HCN3

TCAYVFQPELLVTRVVEISIMEPDVPLPQTLLSHPSYLKVFVPDYTRELLLELRDCVSNGSLGCPVRLTVGPVTLPSNFQKVL