PLEKHF2 Fragment MS Protein Standard

Pleckstrin homology domain-containing family F member 2

PLEKHF2 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human PLEKHF2 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

PLEKHF2

Endoplasmic reticulum-associated apoptosis-involved protein containing PH and FYVE domains, PH and FYVE domain-containing protein 2, Phafin-2, Zinc finger FYVE domain-containing protein 18

Q9H8W4

CGFVVCGPCSEKRFLLPSQSSKPVRICDFCYDLLSAGDMATCQPARSDSYSQSLKSPLNDMSDDDDDD