UBE2Z Fragment MS Protein Standard

Ubiquitin-conjugating enzyme E2 Z

UBE2Z Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human UBE2Z protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

UBE2Z

Uba6-specific E2 conjugating enzyme 1, Ubiquitin carrier protein Z, Ubiquitin-protein ligase Z

Q9H832

ISSVLISIQSLMTENPYHNEPGFEQERHPGDSKNYNECIRHETIRVAVCDMMEGKCPCPEPLRGVMEKSFLEYYDFYEVACKDRLHLQGQTMQDPFGEKR