TUT1 Fragment MS Protein Standard

Speckle targeted PIP5K1A-regulated poly(A) polymerase

TUT1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human TUT1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

TUT1

RNA-binding motif protein 21, U6 snRNA-specific terminal uridylyltransferase 1

Q9H6E5

LASPQSLPPASPLLEDREEGDLGKASELAETPKEEKAEGAAMLELVGSILRGCVPGVYRVQTVPSARRPVVKFCHRPSGLHGD