TFB2M Fragment MS Protein Standard

Dimethyladenosine transferase 2, mitochondrial

TFB2M Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human TFB2M protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

TFB2M

Hepatitis C virus NS5A-transactivated protein 5, Mitochondrial 12S rRNA dimethylase 2, Mitochondrial transcription factor B2, S-adenosylmethionine-6-N, N-adenosyl(rRNA) dimethyltransferase 2

Q9H5Q4

HLLKHCFGRRSATVIDHLRSLTPLDARDILMQIGKQEDEKVVNMHPQDFKTLFETIERSKDCAYKWLYDETLED